8 sr engineer jobs found for you

filter3
clear all
    • gurgoan
    • permanent
    PositionResponsibilities: PriortizedatagatheredfromfinancialreportsintoExcelworkbookanalysesthatprovidesvaluableguidancetotheU.S.basedengagementteamonspecificreviewsofcompanyfinancialsinthefast-pacedworldofmergersandacquisitions Prepareandupdatedocumentrequestlistsandmanagementmeetingagendas ParticipateinmanagementmeetingswiththeTargetCompanyanddiscussionswiththeClient AssistinpreparingQualityofEarningsadjustments,NetWorkingCapitalanalyses,identifyingD
    PositionResponsibilities: PriortizedatagatheredfromfinancialreportsintoExcelworkbookanalysesthatprovidesvaluableguidancetotheU.S.basedengagementteamonspecificreviewsofcompanyfinancialsinthefast-pacedworldofmergersandacquisitions Prepareandupdatedocumentrequestlistsandmanagementmeetingagendas ParticipateinmanagementmeetingswiththeTargetCompanyanddiscussionswiththeClient AssistinpreparingQualityofEarningsadjustments,NetWorkingCapitalanalyses,identifyingD
    • pune, maharashtra
    • temporary
    Job Title-Junior Engineering  Reporting Supervisor :  DE / AME JOB PROFILE (E – Essential) Qualification (E)           Diploma /ITIOverall Experience       3 – 5 yearsIndustry Type                IT Company & Manufacturing Company Industry Experience     3-5 yearTechnical Skills (E)      M&E Related Equipment’s, MS Office & Mail communication Generic Skills (E)         Communication, InterpersonalBehaviors                     Achievement level, Team work,
    Job Title-Junior Engineering  Reporting Supervisor :  DE / AME JOB PROFILE (E – Essential) Qualification (E)           Diploma /ITIOverall Experience       3 – 5 yearsIndustry Type                IT Company & Manufacturing Company Industry Experience     3-5 yearTechnical Skills (E)      M&E Related Equipment’s, MS Office & Mail communication Generic Skills (E)         Communication, InterpersonalBehaviors                     Achievement level, Team work,
    • satpura
    • temporary
    Senior Installation Supervisor (Contract) - Bhopal, MPWe are seeking a highly experienced and proactive Senior Installation Supervisor to join our team on a contract basis in Bhopal, Madhya Pradesh. The ideal candidate will possess a strong background in installations, with specific expertise in KAVACH systems, railways, and monitoring relay wiring. This role requires a meticulous individual capable of overseeing complex projects and ensuring successful ou
    Senior Installation Supervisor (Contract) - Bhopal, MPWe are seeking a highly experienced and proactive Senior Installation Supervisor to join our team on a contract basis in Bhopal, Madhya Pradesh. The ideal candidate will possess a strong background in installations, with specific expertise in KAVACH systems, railways, and monitoring relay wiring. This role requires a meticulous individual capable of overseeing complex projects and ensuring successful ou
    • putlibowli
    • permanent
    MAJOR RESPONSIBILITIES AND ACCOUNTABILITIES·Develop and maintain Infrastructure as Code (IaC) using tools like Terraform, Ansible, Dynatrace to automate deployment and management of infrastructure.·Build and manage CI/CD pipelines to ensure efficient and reliable application deployments.·Improve infrastructure provisioning and configuration through automation, minimizing manual interventions and reducing human error.·Monitor the health, performance, and re
    MAJOR RESPONSIBILITIES AND ACCOUNTABILITIES·Develop and maintain Infrastructure as Code (IaC) using tools like Terraform, Ansible, Dynatrace to automate deployment and management of infrastructure.·Build and manage CI/CD pipelines to ensure efficient and reliable application deployments.·Improve infrastructure provisioning and configuration through automation, minimizing manual interventions and reducing human error.·Monitor the health, performance, and re
    • bhubaneswar, odisha
    • temporary
    Job Title- Procurement Jr. Professional Job Location- Bhubaneswar OdishaWorking Day- 6 Slary upto - 9 LPA  Experience Minimum 3 Years in handling high value contracts for different services such as Mining, Geology, Project, Plant & Machinery, Operation & Maintenance, Civil Works, Manpower, IT Services etc. Experience & knowledge in SAP MM Module/ e-procurement/ GeM Portal/ Procurement in Govt. sector/ PSU (Other keywords: Materials management, Logistics Ma
    Job Title- Procurement Jr. Professional Job Location- Bhubaneswar OdishaWorking Day- 6 Slary upto - 9 LPA  Experience Minimum 3 Years in handling high value contracts for different services such as Mining, Geology, Project, Plant & Machinery, Operation & Maintenance, Civil Works, Manpower, IT Services etc. Experience & knowledge in SAP MM Module/ e-procurement/ GeM Portal/ Procurement in Govt. sector/ PSU (Other keywords: Materials management, Logistics Ma
    • bengaluru, karnataka
    • permanent
    Data Data Engineer About Woodside Energy  We are a global energy company, providing reliable and affordable energy to help people lead better lives. Join our team at Woodside Global Solutions in Bengaluru where talent, digital expertise, and operational excellence converge to solve complex energy challenges, accelerate change, and reimagine business capabilities to support Woodside's global operations and our role in the energy transition. Founded in 1954,
    Data Data Engineer About Woodside Energy  We are a global energy company, providing reliable and affordable energy to help people lead better lives. Join our team at Woodside Global Solutions in Bengaluru where talent, digital expertise, and operational excellence converge to solve complex energy challenges, accelerate change, and reimagine business capabilities to support Woodside's global operations and our role in the energy transition. Founded in 1954,
    • raigarh, chhattisgarh
    • permanent
    Experience & Domain Knowledge• Minimum 20 years of experience in Contracts, Claims, Arbitration, and Commercial Managementwithin EPC/Design-Build projects.• Proven track record in managing national and international projects with consultants and clients.• Expertise in PPP, EPC and DBO contract structures including drafting, interpretation, andimplementation of clauses.• Skilled in preparing, evaluating, and defending time and cost claims; well-versed in ar
    Experience & Domain Knowledge• Minimum 20 years of experience in Contracts, Claims, Arbitration, and Commercial Managementwithin EPC/Design-Build projects.• Proven track record in managing national and international projects with consultants and clients.• Expertise in PPP, EPC and DBO contract structures including drafting, interpretation, andimplementation of clauses.• Skilled in preparing, evaluating, and defending time and cost claims; well-versed in ar
    • chennai, tamil nadu
    • permanent
    Must have competencies:Technical Skills 5-10 years of experience in software development using C++ programming language.Classified as Business Experience in preparing software architecture, design for the development of softwareproducts. Ability to create and/or read and interpret, the architecture and design diagrams. Experience in Software Development using Agile Scrum methodology. Excellent debugging skills. Excellent analytical skills and ability
    Must have competencies:Technical Skills 5-10 years of experience in software development using C++ programming language.Classified as Business Experience in preparing software architecture, design for the development of softwareproducts. Ability to create and/or read and interpret, the architecture and design diagrams. Experience in Software Development using Agile Scrum methodology. Excellent debugging skills. Excellent analytical skills and ability

It looks like you want to switch your language. This will reset your filters on your current job search.